A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10391 |
Swiss-prot Accession number | O45027 (Sequence in FASTA format) |
Description | PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide (MAB-alpha-NP); Beta-SG neuropeptide (MAB-beta-NP); Pheromone biosynthesis-activating neuropeptide (MaB-PBAN);Gamma-SG neuropeptide (MAB-gamma-NP)] (Fragment). |
Source organism | Mamestra brassicae (Cabbage armyworm) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Hadeninae; Mamestra. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the pyrokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 155 Amino acids |
Molecular weight | 18096 |
References | 1 PubMed abstract 9684333 |
Domain Name | N/A |
Hormone Name | Diapause hormone homolog |
Mature Hormone Sequence | GLWFGPRI |
Position of mature hormone in Pre-Hormone protein | fragment Residues from position |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10392 |
Swiss-prot Accession number | O45027 (Sequence in FASTA format) |
Description | PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide (MAB-alpha-NP); Beta-SG neuropeptide (MAB-beta-NP); Pheromone biosynthesis-activating neuropeptide (MaB-PBAN);Gamma-SG neuropeptide (MAB-gamma-NP)] (Fragment). |
Source organism | Mamestra brassicae (Cabbage armyworm) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Hadeninae; Mamestra. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the pyrokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 155 Amino acids |
Molecular weight | 18096 |
References | 1 PubMed abstract 9684333 |
Domain Name | N/A |
Hormone Name | Alpha-SG neuropeptide |
Mature Hormone Sequence | VIFTPKL |
Position of mature hormone in Pre-Hormone protein | 7 Residues from position (58-64) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10393 |
Swiss-prot Accession number | O45027 (Sequence in FASTA format) |
Description | PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide (MAB-alpha-NP); Beta-SG neuropeptide (MAB-beta-NP); Pheromone biosynthesis-activating neuropeptide (MaB-PBAN);Gamma-SG neuropeptide (MAB-gamma-NP)] (Fragment). |
Source organism | Mamestra brassicae (Cabbage armyworm) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Hadeninae; Mamestra. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the pyrokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 155 Amino acids |
Molecular weight | 18096 |
References | 1 PubMed abstract 9684333 |
Domain Name | N/A |
Hormone Name | Beta-SG neuropeptide |
Mature Hormone Sequence | SLAYDDKVFENVEFTPRL |
Position of mature hormone in Pre-Hormone protein | 18 Residues from position (67-84) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10394 |
Swiss-prot Accession number | O45027 (Sequence in FASTA format) |
Description | PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide (MAB-alpha-NP); Beta-SG neuropeptide (MAB-beta-NP); Pheromone biosynthesis-activating neuropeptide (MaB-PBAN);Gamma-SG neuropeptide (MAB-gamma-NP)] (Fragment). |
Source organism | Mamestra brassicae (Cabbage armyworm) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Hadeninae; Mamestra. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the pyrokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | PBAN is an hormone that controls sex pheromone production in female moths and pheromone responsiveness in male. PBAN also mediates visceral muscle contractile activity (myotropic activity) |
Protein Length | 155 Amino acids |
Molecular weight | 18096 |
References | 1 PubMed abstract 9684333 |
Domain Name | N/A |
Hormone Name | Pheromone biosynthesis-activating neuropeptide |
Mature Hormone Sequence | LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (88-120) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10395 |
Swiss-prot Accession number | O45027 (Sequence in FASTA format) |
Description | PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide (MAB-alpha-NP); Beta-SG neuropeptide (MAB-beta-NP); Pheromone biosynthesis-activating neuropeptide (MaB-PBAN);Gamma-SG neuropeptide (MAB-gamma-NP)] (Fragment). |
Source organism | Mamestra brassicae (Cabbage armyworm) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Hadeninae; Mamestra. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the pyrokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 155 Amino acids |
Molecular weight | 18096 |
References | 1 PubMed abstract 9684333 |
Domain Name | N/A |
Hormone Name | Gamma-SG neuropeptide |
Mature Hormone Sequence | TMNFSPRL |
Position of mature hormone in Pre-Hormone protein | 8 Residues from position (123-130) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |